|
Type: Recombinant |
Cat. No.: 41050 |
|
Tag: His |
Size: 0.1 mg |
|
Source: E.Coli |
Purity: >90% |
|
Other names: 24p3; MSFI; NGAL |
Species: Human |
Introduction
Lipocalin-2 (LCN2), also known as neutrophil gelatinase-associated lipocalin (NGAL), 24p3, siderocalin, or neutrophil lipocalin (NL),
is a secretory glycoprotein which is expressed in liver, lung, kidney, adipocytes, activated neutrophils, and macrophages. LCN2
appears to be upregulated in the case of information and infection conditions. Several reports suggest that LCN2 may represent a
sensitive biomarker for various renal injuries and somehow may be involved in the pathophysiological process of some chronic renal diseases. LCN2 is also high expressed under high fat diet and obese background especially in adipose tissue and is closely
associated with obesity, insulin resistance, and hyperglycemia in humans.
Description
Total 206 AA. Mw: 23.9kDa (calculated).
N-terminal His-tag and TEV cleavage site, 28 extra AA (highlighted).
Amino Acid Sequence
MSYYHHHHHHDYDIPTTENLYFQGAMGSQDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGN
AILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVR
VVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG
Formulation
Lyophilized in 1 mg/mL in PBS.
Reconstitution
Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the lyophilized pellet dissolve completely.
Storage
Store lyophilized protein at -20°C. Aliquot reconstituted protein and store at -80°C. Avoid repeated freezing/thawing cycles.
Quality Control Test
BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein.
Application
ELISA and Western blotting.


