★Download Datasheet★

Introduction
Fatty acid binding protein 4(FABP4), also termed adipocyte fatty acid binding protein (A-FABP), or aP2, is a novel
adipocyte-expressed factor which accounted for ~6% of total cellular proteins. Several animal experiments suggested that FABP-4
plays a key role in the link between obesity and various features of metabolic syndrome. Mice with targeted disruption of FABP-4
accompany FABP-5 almost completely protect against diet-induced obesity, insulin resistance, dyslipidemia, type 2 diabetes, and
fatty liver disease. Studies in human found FABP-4 serum levels were significantly increased in overweight and obese subjects,
which predicted the risk to develop metabolic syndrome and type 2 diabetes. Additionally, serum FABP-4 levels were associated with carotid atherosclerosis and coronary artery disease.

Description

Total 160 AA. Mw: 18 KDa (calculated).

N-terminal His-tag and TEV cleavage site, 28 extra AA (highlighted).

Amino Acid Sequence

MSYYHHHHHHDYDIPTTENLYFQGAMGSMCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVA
GMAKPNMIISVNGDLVTIRSESTFKNTEISFKLGVEFDEITADDRKVKSIITLDGGALVQVQKWDGK
STTIKRKRDGDKLVVECVMKGVTSTRVYERA

Formulation

Lyophilized in 1 mg/mL in PBS.

Reconstitution

Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the lyophilized pellet dissolve completely.

Storage

Store lyophilized protein at -20°C. Aliquot reconstituted protein and store at -80°C. Avoid repeated freezing/thawing cycles.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

Application

ELISA and Western blotting.

Endotoxin Level

<0.2 EU/μg.

Publications Citing This Product

1. Wu X, Shu L, Zhang Z, Li J, Zong J, Cheong LY, Ye D, Lam KS, Song E, Wang C, Xu A. Adipocyte Fatty Acid Binding Protein Promotes the Onset and Progression of Liver Fibrosis via Mediating the Crosstalk between Liver Sinusoidal Endothelial Cells and Hepatic Stellate Cells. Advanced Science. 2021:2003721.